Lineage for d2q57a_ (2q57 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1407410Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1407411Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1407412Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1407645Protein automated matches [190406] (14 species)
    not a true protein
  7. 1407807Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (40 PDB entries)
  8. 1407862Domain d2q57a_: 2q57 A: [167422]
    automated match to d1qyoa_

Details for d2q57a_

PDB Entry: 2q57 (more details), 2 Å

PDB Description: x-ray structure of cerulean gfp: a tryptophan-based chromophore useful for fluorescence lifetime imaging
PDB Compounds: (A:) Cerulean Green fluorescent protein

SCOPe Domain Sequences for d2q57a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q57a_ d.22.1.1 (A:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
mskgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptl
vttltwgvqcfarypdhmkrhdffksampegyvqertiffkddgnyktraevkfegdtlv
nrielkgidfkedgnilghkleynaisdnvyitadkqkngikanfkirhniedgsvqlad
hyqqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagi

SCOPe Domain Coordinates for d2q57a_:

Click to download the PDB-style file with coordinates for d2q57a_.
(The format of our PDB-style files is described here.)

Timeline for d2q57a_: