Lineage for d2pwmc_ (2pwm C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330931Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2330932Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2330933Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2330972Protein HIV-1 capsid protein [47945] (1 species)
  7. 2330973Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)
  8. 2331025Domain d2pwmc_: 2pwm C: [167304]
    automated match to d1afva_
    complexed with cl

Details for d2pwmc_

PDB Entry: 2pwm (more details), 1.9 Å

PDB Description: crystal structure of hiv-1 ca146 a92e real cell
PDB Compounds: (C:) Gag-Pol polyprotein

SCOPe Domain Sequences for d2pwmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pwmc_ a.73.1.1 (C:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiepgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmy

SCOPe Domain Coordinates for d2pwmc_:

Click to download the PDB-style file with coordinates for d2pwmc_.
(The format of our PDB-style files is described here.)

Timeline for d2pwmc_: