SCOPe 2.03: Domain d2pf0a_: 2pf0 A:

Lineage for d2pf0a_ (2pf0 A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein automated matches [190057] (15 species)
   not a true protein

7. Species Yeast (Candida albicans) [TaxId:5476] [188406] (5 PDB entries)

8. Domain d2pf0a_: 2pf0 A: [167163]
   automated match to d1cz1a_
   mutant

Details for d2pf0a_

PDB Entry: 2pf0, 1.9 Å

PDB Description: f258i mutant of exo-b-(1,3)-glucanase from candida albicans at 1.9 a

PDB Compounds: (A:) Hypothetical protein XOG1

SCOPe Domain Sequences for d2pf0a_:

Sequence; same for both SEQRES and ATOM records:

>d2pf0a_ c.1.8.3 (A:) automated matches {Yeast (Candida albicans) [TaxId: 5476]}
awdydnnvirgvnlggwfvlepymtpslfepfqngndqsgvpvdeyhwtqtlgkeaalri
lqkhwstwiteqdfkqisnlglnfvripigywafqlldndpyvqgqvqylekalgwarkn
nirvwidlhgapgsqngfdnsglrdsynfqngdntqvtlnvlntifkkyggneysdvvig
iellneplgpvlnmdklkqffldgynslrqtgsvtpviihdafqvfgywnnfltvaegqw
nvvvdhhhyqvisggelsrnindhisvacnwgwdakkeshwnvagewsaaltdcakwlng
vnrgaryegaydnapyigscqplldisqwsdehktdtrryieaqldafeytggwvfwswk
tenapewsfqtltynglfpqpvtdrqfpnqcgfh

Timeline for d2pf0a_:

• d2pf0a_ first appeared in SCOPe 2.01
  
• d2pf0a_ appears in SCOPe 2.02
  
• d2pf0a_ appears in SCOPe 2.04
  
• d2pf0a_ appears in the current release, SCOPe 2.08