Lineage for d1mfrm_ (1mfr M:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 212183Fold a.25: Ferritin-like [47239] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 212184Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 212185Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 212186Protein (Apo)ferritin [47246] (4 species)
  7. 212187Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (7 PDB entries)
  8. 212206Domain d1mfrm_: 1mfr M: [16704]

Details for d1mfrm_

PDB Entry: 1mfr (more details), 2.8 Å

PDB Description: crystal structure of m ferritin

SCOP Domain Sequences for d1mfrm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfrm_ a.25.1.1 (M:) (Apo)ferritin {Bullfrog (Rana catesbeiana)}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsv

SCOP Domain Coordinates for d1mfrm_:

Click to download the PDB-style file with coordinates for d1mfrm_.
(The format of our PDB-style files is described here.)

Timeline for d1mfrm_: