Lineage for d1mfrl_ (1mfr L:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279616Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 279617Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
    contains dimetal-ion centre in the middle of the bundle
  5. 279618Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 279619Protein (Apo)ferritin [47246] (4 species)
  7. 279620Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (7 PDB entries)
  8. 279638Domain d1mfrl_: 1mfr L: [16703]

Details for d1mfrl_

PDB Entry: 1mfr (more details), 2.8 Å

PDB Description: crystal structure of m ferritin

SCOP Domain Sequences for d1mfrl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfrl_ a.25.1.1 (L:) (Apo)ferritin {Bullfrog (Rana catesbeiana)}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsv

SCOP Domain Coordinates for d1mfrl_:

Click to download the PDB-style file with coordinates for d1mfrl_.
(The format of our PDB-style files is described here.)

Timeline for d1mfrl_: