SCOPe 2.07: Domain d2p3wb1: 2p3w B:354-461

Lineage for d2p3wb1 (2p3w B:354-461)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187333] (105 PDB entries)

8. Domain d2p3wb1: 2p3w B:354-461 [166999]
   Other proteins in same PDB: d2p3wa2, d2p3wb2
   automated match to d2pzda1

Details for d2p3wb1

PDB Entry: 2p3w, 1.7 Å

PDB Description: crystal structure of the htra3 pdz domain bound to a phage-derived ligand (fgrwv)

PDB Compounds: (B:) Probable serine protease HTRA3

SCOPe Domain Sequences for d2p3wb1:

Sequence, based on SEQRES records:

>d2p3wb1 b.36.1.0 (B:354-461) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krfigirmrtitpslvdelkasnpdfpevssgiyvqevapnspsqrggiqdgdiivkvng
rplvdsselqeavltesplllevrrgnddllfsiapevvmgggfgrwv

Sequence, based on observed residues (ATOM records):

>d2p3wb1 b.36.1.0 (B:354-461) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krfigirmrtitpslvdepevssgiyvqevapnspsqrggiqdgdiivkvngrplvdsse
lqeavltesplllevrrgnddllfsiapevvmgggfgrwv

Timeline for d2p3wb1:

• d2p3wb1 first appeared in SCOPe 2.01, called d2p3wb_
  
• d2p3wb1 appears in SCOPe 2.06
  
• d2p3wb1 appears in the current release, SCOPe 2.08