![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein automated matches [190124] (13 species) not a true protein |
![]() | Species Zebrafish (Danio rerio) [TaxId:7955] [188346] (1 PDB entry) |
![]() | Domain d2oxqb1: 2oxq B:1-147 [166913] Other proteins in same PDB: d2oxqa2, d2oxqb2, d2oxqc_, d2oxqd_ automated match to d1ur6a_ complexed with cl |
PDB Entry: 2oxq (more details), 2.9 Å
SCOPe Domain Sequences for d2oxqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oxqb1 d.20.1.1 (B:1-147) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} malkriqkelqdlqrdppaqcsagpvgddlfhwqatimgpsdspyqggvffltihfptdy pfkppkvafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpnpddplv pdiahiyksdkekynrlarewtqkyam
Timeline for d2oxqb1:
![]() Domains from other chains: (mouse over for more information) d2oxqa1, d2oxqa2, d2oxqc_, d2oxqd_ |