Lineage for d1rcg__ (1rcg -)
- Root: SCOP 1.57
Class a: All alpha proteins [46456] (144 folds) 
Fold a.25: Ferritin-like [47239] (1 superfamily) Superfamily a.25.1: Ferritin-like [47240] (2 families) 
Family a.25.1.1: Ferritin [47241] (5 proteins) Protein (Apo)ferritin [47246] (4 species) 
Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (7 PDB entries) 
Domain d1rcg__: 1rcg - [16689]
Details for d1rcg__
PDB Entry: 1rcg (more details), 2.2 Å
PDB Description: bullfrog red cell l ferritin sulfate/mn/ph 6.3
SCOP Domain Sequences for d1rcg__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rcg__ a.25.1.1 (-) (Apo)ferritin {Bullfrog (Rana catesbeiana)}
sqvrqnfhqdceaglnrtvnlkfhssyvylsmasyfnrddvalsnfakffrerseeekeh
aeklieyqnqrggrvflqsvekperddwanglealqtalklqksvnqalldlhavaadks
dphmtdflespylsesvetikklgdhitslkklwsshpgmaeylfnkhtlg
SCOP Domain Coordinates for d1rcg__:
Click to download the PDB-style file with coordinates for d1rcg__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rcg__:
- d1rcg__ first appeared (with stable ids) in SCOP 1.55
- d1rcg__ appears in SCOP 1.59
- d1rcg__ appears in the current release, SCOPe 2.08, called d1rcga_
View in 3D