SCOPe 2.07: Domain d1dvba1: 1dvb A:1-147

Lineage for d1dvba1 (1dvb A:1-147)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Rubrerythrin, N-terminal domain [47242] (2 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [47243] (10 PDB entries)
   Uniprot P24931

8. Domain d1dvba1: 1dvb A:1-147 [16645]
   Other proteins in same PDB: d1dvba2
   complexed with fe, zn

Details for d1dvba1

PDB Entry: 1dvb, 1.9 Å

PDB Description: rubrerythrin

PDB Compounds: (A:) rubrerythrin

SCOPe Domain Sequences for d1dvba1:

Sequence; same for both SEQRES and ATOM records:

>d1dvba1 a.25.1.1 (A:1-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
mkslkgsrtekniltafagesqarnrynyfggqakkdgfvqisdifaetadqerehakrl
fkfleggdleivaafpagiiadthanliasaagehheytemypsfariareegyeeiarv
fasiavaeefhekrfldfarnikegrv

Timeline for d1dvba1:

• d1dvba1 first appeared (with stable ids) in SCOP 1.55
  
• d1dvba1 appears in SCOPe 2.06
  
• d1dvba1 appears in the current release, SCOPe 2.08