Lineage for d2nrla_ (2nrl A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301856Protein automated matches [190359] (44 species)
    not a true protein
  7. 2302270Species Thunnus atlanticus [TaxId:48168] [187921] (8 PDB entries)
  8. 2302278Domain d2nrla_: 2nrl A: [166333]
    automated match to d1myta_
    complexed with edo, hem

Details for d2nrla_

PDB Entry: 2nrl (more details), 0.91 Å

PDB Description: blackfin tuna myoglobin
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d2nrla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nrla_ a.1.1.2 (A:) automated matches {Thunnus atlanticus [TaxId: 48168]}
adfdavlkcwgpveadyttigglvltrlfkehpetqklfpkfagiaqadiagnaavsahg
atvlkklgellkakgshaailkplanshatkhkipinnfklisevlvkvmqekagldagg
qtalrnvmgiiiadleanykelgfs

SCOPe Domain Coordinates for d2nrla_:

Click to download the PDB-style file with coordinates for d2nrla_.
(The format of our PDB-style files is described here.)

Timeline for d2nrla_: