SCOPe 2.03: Domain d2nnwb_: 2nnw B:

Lineage for d2nnwb_ (2nnw B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families)

5. Family c.66.1.3: Fibrillarin homologue [53342] (1 protein)
   automatically mapped to Pfam PF01269

6. Protein Fibrillarin homologue [53343] (4 species)

7. Species Pyrococcus furiosus [TaxId:2261] [224904] (3 PDB entries)

8. Domain d2nnwb_: 2nnw B: [166314]
   automated match to d1prya_

Details for d2nnwb_

PDB Entry: 2nnw, 2.7 Å

PDB Description: Alternative conformations of Nop56/58-fibrillarin complex and implication for induced-fit assenly of box C/D RNPs

PDB Compounds: (B:) Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase

SCOPe Domain Sequences for d2nnwb_:

Sequence; same for both SEQRES and ATOM records:

>d2nnwb_ c.66.1.3 (B:) Fibrillarin homologue {Pyrococcus furiosus [TaxId: 2261]}
mvevkkhkfpgvyvvidddgsekiatknlvpgqrvygervikwegeeyriwnphrsklga
aivnglknfpikpgksvlylgiasgttashvsdivgwegkiygiefsprvlrelvpivee
rrniipilgdatkpeeyralvtkvdvifedvaqptqakilidnakaylkrggygmiavks
rsidvtkepeqvfkeverelseyfevierlnlepyekdhalfvvrkp

Timeline for d2nnwb_:

• d2nnwb_ first appeared in SCOPe 2.01
  
• d2nnwb_ appears in SCOPe 2.02
  
• d2nnwb_ appears in SCOPe 2.04
  
• d2nnwb_ appears in the current release, SCOPe 2.08