SCOP 1.67: Domain d1dova_: 1dov A:

Lineage for d1dova_ (1dov A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (20 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.9: alpha-catenin/vinculin [47220] (1 family)

5. Family a.24.9.1: alpha-catenin/vinculin [47221] (2 proteins)
   possible duplication: contains several domains of this fold
   The listed PDB entries contain different large fragments but not the whole proteins

6. Protein alpha-catenin [47222] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47223] (2 PDB entries)

8. Domain d1dova_: 1dov A: [16627]
   N-terminal, dimerization and beta-catenin binding domain

Details for d1dova_

PDB Entry: 1dov, 3 Å

PDB Description: crystal structure of the alpha-catenin dimerization domain

SCOP Domain Sequences for d1dova_:

Sequence; same for both SEQRES and ATOM records:

>d1dova_ a.24.9.1 (A:) alpha-catenin {Mouse (Mus musculus)}
esqflkeelvvavedvrkqgdlmksaagefaddpcssvkrgnmvraarallsavtrllil
admadvykllvqlkvvedgilklrnagneqdlgiqykalkpevdklnimaakrqqelkdv
gnrdqmaaargilqknvpilytasqaclqhpdvaaykanrdliykqlqqavtgisnaaqa
t

Timeline for d1dova_:

• d1dova_ first appeared (with stable ids) in SCOP 1.55
  
• d1dova_ appears in SCOP 1.65
  
• d1dova_ appears in SCOP 1.69
  
• d1dova_ appears in the current release, SCOPe 2.08