Class a: All alpha proteins [46456] (202 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (20 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.9: alpha-catenin/vinculin [47220] (1 family) |
Family a.24.9.1: alpha-catenin/vinculin [47221] (2 proteins) possible duplication: contains several domains of this fold The listed PDB entries contain different large fragments but not the whole proteins |
Protein alpha-catenin [47222] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [47223] (2 PDB entries) |
Domain d1dowa_: 1dow A: [16626] chimera of the N-terminal domain of alpha-catenin and beta-catenin fragment (chain B) |
PDB Entry: 1dow (more details), 1.8 Å
SCOP Domain Sequences for d1dowa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dowa_ a.24.9.1 (A:) alpha-catenin {Mouse (Mus musculus)} kahvlaasveqatenflekgdkiakesqflkeelvvavedvrkqgdlmksaagefaddpc ssvkrgnmvraarallsavtrlliladmadvykllvqlkvvedgilklrnagneqdlgiq ykalkpevdklnimaakrqqelkdvgnrdqmaaargilqknvpilytasqaclqhpdvaa ykanrdliykqlqqavtgisnaaqa
Timeline for d1dowa_: