Lineage for d2jhmf_ (2jhm F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2608754Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
    unusual fold
  4. 2608755Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families) (S)
  5. 2608856Family d.171.1.0: automated matches [191465] (1 protein)
    not a true family
  6. 2608857Protein automated matches [190726] (1 species)
    not a true protein
  7. 2608858Species Human (Homo sapiens) [TaxId:9606] [187887] (49 PDB entries)
  8. 2608861Domain d2jhmf_: 2jhm F: [166194]
    automated match to d1jc9a_
    complexed with ca, epe, ipa

Details for d2jhmf_

PDB Entry: 2jhm (more details), 1.52 Å

PDB Description: structure of globular heads of m-ficolin at neutral ph
PDB Compounds: (F:) ficolin-1

SCOPe Domain Sequences for d2jhmf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jhmf_ d.171.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
scatgprnckdlldrgyflsgwhtiylpdcrpltvlcdmdtdgggwtvfqrrmdgsvdfy
rdwaaykqgfgsqlgefwlgndnihaltaqgsselrtdlvdfegnhqfakyksfkvadea
ekyklvlgafvggsagnsltghnnnffstkdqdndvsssncaekfqgawwyadchasnln
glylmgphesyanginwsaakgykysykvsemkvrpa

SCOPe Domain Coordinates for d2jhmf_:

Click to download the PDB-style file with coordinates for d2jhmf_.
(The format of our PDB-style files is described here.)

Timeline for d2jhmf_: