Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (58 species) not a true protein |
Species Pyrococcus furiosus [TaxId:2261] [187908] (4 PDB entries) |
Domain d2jd7j_: 2jd7 J: [166066] automated match to d1vlga_ complexed with fe, so4 |
PDB Entry: 2jd7 (more details), 2.8 Å
SCOPe Domain Sequences for d2jd7j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2jd7j_ a.25.1.0 (J:) automated matches {Pyrococcus furiosus [TaxId: 2261]} mlsermlkalndqlnrelysaylyfamaayfedlglegfanwmkaqaeeeighalrfyny iydrngrveldeipkppkewesplkafeaayehekfisksiyelaalaeeekdystrafl ewfineqveeeasvkkildklkfakdspqilfmldkelsarapklpg
Timeline for d2jd7j_:
View in 3D Domains from other chains: (mouse over for more information) d2jd70_, d2jd71_, d2jd72_, d2jd73_, d2jd74_, d2jd75_, d2jd76_, d2jd77_, d2jd78_, d2jd79_, d2jd7a_, d2jd7b_, d2jd7c_, d2jd7d_, d2jd7e_, d2jd7f_, d2jd7g_, d2jd7h_, d2jd7i_, d2jd7k_, d2jd7l_, d2jd7m_, d2jd7n_, d2jd7o_, d2jd7p_, d2jd7q_, d2jd7r_, d2jd7s_, d2jd7t_, d2jd7u_, d2jd7v_, d2jd7w_, d2jd7x_, d2jd7y_, d2jd7z_ |