SCOPe 2.07: Domain d2j2pe_: 2j2p E:

Lineage for d2j2pe_ (2j2p E:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
   unusual fold

4. Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (2 families)

5. Family d.171.1.0: automated matches [191465] (1 protein)
   not a true family

6. Protein automated matches [190726] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187887] (49 PDB entries)

8. Domain d2j2pe_: 2j2p E: [165826]
   automated match to d1jc9a_
   complexed with bma, ca, sc2

Details for d2j2pe_

PDB Entry: 2j2p, 2.8 Å

PDB Description: l-ficolin complexed to n-acetyl-cystein (150mm)

PDB Compounds: (E:) ficolin-2

SCOPe Domain Sequences for d2j2pe_:

Sequence; same for both SEQRES and ATOM records:

>d2j2pe_ d.171.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
npcltgprtckdlldrghflsgwhtiylpdcrpltvlcdmdtdgggwtvfqrrvdgsvdf
yrdwatykqgfgsrlgefwlgndnihaltaqgtselrtdlvdfednyqfakyrsfkvade
aekynlvlgafvegsagdsltfhnnqsfstkdqdndlntgncavmfqgawwyknchtsnl
ngrylrgthgsfanginwksgkgynysykvsemkvrpa

Timeline for d2j2pe_:

• d2j2pe_ first appeared in SCOPe 2.01
  
• d2j2pe_ appears in SCOPe 2.06
  
• d2j2pe_ appears in the current release, SCOPe 2.08