Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (10 proteins) |
Protein automated matches [190041] (34 species) not a true protein |
Species Listeria monocytogenes [TaxId:1639] [187885] (1 PDB entry) |
Domain d2iy4o_: 2iy4 O: [165755] automated match to d1qgha_ complexed with fe |
PDB Entry: 2iy4 (more details), 2.31 Å
SCOPe Domain Sequences for d2iy4o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iy4o_ a.25.1.1 (O:) automated matches {Listeria monocytogenes [TaxId: 1639]} svdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerll aiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegd nvtndmliafkasidkhiwmfkaflgkaple
Timeline for d2iy4o_: