Lineage for d2iy4o_ (2iy4 O:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2315402Protein automated matches [190041] (34 species)
    not a true protein
  7. 2315923Species Listeria monocytogenes [TaxId:1639] [187885] (1 PDB entry)
  8. 2315938Domain d2iy4o_: 2iy4 O: [165755]
    automated match to d1qgha_
    complexed with fe

Details for d2iy4o_

PDB Entry: 2iy4 (more details), 2.31 Å

PDB Description: x-ray structure of dps from listeria monocytogenes
PDB Compounds: (O:) non-heme iron-containing ferritin

SCOPe Domain Sequences for d2iy4o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iy4o_ a.25.1.1 (O:) automated matches {Listeria monocytogenes [TaxId: 1639]}
svdtkeflnhqvanlnvftvkihqihwymrghnfftlhekmddlysefgeqmdevaerll
aiggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeyqqgieltdkegd
nvtndmliafkasidkhiwmfkaflgkaple

SCOPe Domain Coordinates for d2iy4o_:

Click to download the PDB-style file with coordinates for d2iy4o_.
(The format of our PDB-style files is described here.)

Timeline for d2iy4o_: