SCOPe 2.04: Domain d2iiha_: 2iih A:

Lineage for d2iiha_ (2iih A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.21: Molybdenum cofactor biosynthesis protein C, MoaC [55040] (2 families)

5. Family d.58.21.0: automated matches [191458] (1 protein)
   not a true family

6. Protein automated matches [190706] (5 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [187852] (5 PDB entries)

8. Domain d2iiha_: 2iih A: [165577]
   automated match to d1ekra_
   complexed with po4

Details for d2iiha_

PDB Entry: 2iih, 1.75 Å

PDB Description: Crystal structure of the molybdenum cofactor biosynthesis protein C (TTHA1789) from thermus theromophilus HB8 (H32 form)

PDB Compounds: (A:) Molybdenum cofactor biosynthesis protein C

SCOPe Domain Sequences for d2iiha_:

Sequence; same for both SEQRES and ATOM records:

>d2iiha_ d.58.21.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
rprmvdvtekpetfrtataeafvelteealsalekggvgkgdplvvaqlagilaakktad
liplchplpltgvevrvellkaekrvrieatvktkaetgvemeamtacavaaltvydmlk
aaskglvisqvrllhkaggksgewrr

Timeline for d2iiha_:

• d2iiha_ first appeared in SCOPe 2.01
  
• d2iiha_ appears in SCOPe 2.03
  
• d2iiha_ appears in SCOPe 2.05
  
• d2iiha_ appears in the current release, SCOPe 2.08