Lineage for d2ided_ (2ide D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561313Superfamily d.58.21: Molybdenum cofactor biosynthesis protein C, MoaC [55040] (2 families) (S)
  5. 2561319Family d.58.21.0: automated matches [191458] (1 protein)
    not a true family
  6. 2561320Protein automated matches [190706] (6 species)
    not a true protein
  7. 2561343Species Thermus thermophilus HB8 [TaxId:300852] [187852] (5 PDB entries)
  8. 2561361Domain d2ided_: 2ide D: [165500]
    automated match to d1ekra_
    complexed with po4

Details for d2ided_

PDB Entry: 2ide (more details), 1.9 Å

PDB Description: Crystal Structure of the molybdenum cofactor biosynthesis protein C (TTHA1789) from Thermus Theromophilus HB8
PDB Compounds: (D:) Molybdenum cofactor biosynthesis protein C

SCOPe Domain Sequences for d2ided_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ided_ d.58.21.0 (D:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
grprmvdvtekpetfrtataeafvelteealsalekggvgkgdplvvaqlagilaakkta
dliplchplpltgvevrvellkaekrvrieatvktkaetgvemeamtacavaaltvydml
kaaskglvisqvrllhkaggksgewrr

SCOPe Domain Coordinates for d2ided_:

Click to download the PDB-style file with coordinates for d2ided_.
(The format of our PDB-style files is described here.)

Timeline for d2ided_: