Class b: All beta proteins [48724] (178 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins) mono-domain proteins |
Protein automated matches [190545] (9 species) not a true protein |
Species Alcaligenes faecalis [TaxId:511] [187784] (4 PDB entries) |
Domain d2iaac_: 2iaa C: [165454] Other proteins in same PDB: d2iaab_, d2iaae_ automated match to d1dyza_ complexed with cu |
PDB Entry: 2iaa (more details), 1.95 Å
SCOPe Domain Sequences for d2iaac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iaac_ b.6.1.1 (C:) automated matches {Alcaligenes faecalis [TaxId: 511]} acdvsiegndsmqfntksivvdktckeftinlkhtgklpkaamghnvvvskksdesavat dgmkaglnndyvkagderviahtsvigggetdsvtfdvsklkegedyaffcsfpghwsim kgtielgs
Timeline for d2iaac_: