Lineage for d2ccyb_ (2ccy B:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 151228Fold a.24: Four-helical up-and-down bundle [47161] (14 superfamilies)
  4. 151264Superfamily a.24.3: Cytochromes [47175] (2 families) (S)
  5. 151275Family a.24.3.2: Cytochrome c' [47179] (1 protein)
  6. 151276Protein Cytochrome c' [47180] (7 species)
  7. 151301Species Rhodospirillum molischianum [TaxId:1083] [47181] (1 PDB entry)
  8. 151303Domain d2ccyb_: 2ccy B: [16545]

Details for d2ccyb_

PDB Entry: 2ccy (more details), 1.67 Å

PDB Description: structure of ferricytochrome c(prime) from rhodospirillum molischianum at 1.67 angstroms resolution

SCOP Domain Sequences for d2ccyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ccyb_ a.24.3.2 (B:) Cytochrome c' {Rhodospirillum molischianum}
qskpedllklrqglmqtlksqwvpiagfaagkadlpadaaqraenmamvaklapigwakg
tealpngetkpeafgsksaeflegwkalatestklaaaakagpdalkaqaaatgkvckac
heefkqd

SCOP Domain Coordinates for d2ccyb_:

Click to download the PDB-style file with coordinates for d2ccyb_.
(The format of our PDB-style files is described here.)

Timeline for d2ccyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ccya_