Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
Protein Major cold shock protein [50283] (4 species) |
Species Bacillus subtilis [TaxId:1423] [50285] (10 PDB entries) |
Domain d2i5mx_: 2i5m X: [165400] automated match to d1cspa_ complexed with mg |
PDB Entry: 2i5m (more details), 2.3 Å
SCOPe Domain Sequences for d2i5mx_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i5mx_ b.40.4.5 (X:) Major cold shock protein {Bacillus subtilis [TaxId: 1423]} mlegkvkwfnsekgfgfievegqddvfvhfsaiqgegfktleegqkvrfeivegnrgpqa anvtke
Timeline for d2i5mx_: