Lineage for d2hz2a_ (2hz2 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299349Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
    lack the first helix (A)
  6. 2299350Protein Protozoan/bacterial hemoglobin [46460] (6 species)
  7. 2299401Species Synechocystis sp. PCC 6803 [TaxId:1148] [81667] (7 PDB entries)
    Uniprot P73925
  8. 2299407Domain d2hz2a_: 2hz2 A: [165335]
    automated match to d1mwba_
    complexed with cd, hem, so4; mutant

Details for d2hz2a_

PDB Entry: 2hz2 (more details), 2 Å

PDB Description: the x-ray crystal structure of ferric synechocystis hemoglobin h117a mutant with a covalent linkage
PDB Compounds: (A:) Cyanoglobin

SCOPe Domain Sequences for d2hz2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hz2a_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Synechocystis sp. PCC 6803 [TaxId: 1148]}
stlyeklggttavdlavdkfyervlqddrikhffadvdmakqrahqkafltyafggtdky
dgrymreahkelvenhglngehfdavaedllatlkemgvpedliaevaavagapaakrdv
lnq

SCOPe Domain Coordinates for d2hz2a_:

Click to download the PDB-style file with coordinates for d2hz2a_.
(The format of our PDB-style files is described here.)

Timeline for d2hz2a_: