Lineage for d2hsab_ (2hsa B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2436512Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2436513Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)
  6. 2436963Protein automated matches [190228] (21 species)
    not a true protein
  7. 2437084Species Solanum lycopersicum [TaxId:4081] [187823] (5 PDB entries)
  8. 2437086Domain d2hsab_: 2hsa B: [165235]
    automated match to d1q45a_
    complexed with cl, fmn, so4

Details for d2hsab_

PDB Entry: 2hsa (more details), 1.5 Å

PDB Description: Crystal structure of 12-oxophytodienoate reductase 3 (OPR3) from tomato
PDB Compounds: (B:) 12-oxophytodienoate reductase 3

SCOPe Domain Sequences for d2hsab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hsab_ c.1.4.1 (B:) automated matches {Solanum lycopersicum [TaxId: 4081]}
plfspykmgkfnlshrvvlapmtrcralnnipqaalgeyyeqrataggflitegtmispt
sagfphvpgiftkeqvrewkkivdvvhakgavifcqlwhvgrashevyqpagaapisste
kpisnrwrilmpdgthgiypkpraigtyeisqvvedyrrsalnaieagfdgieihgahgy
lidqflkdgindrtdeyggslanrckfitqvvqavvsaigadrvgvrvspaidhldamds
nplslglavverlnkiqlhsgsklaylhvtqpryvaygqteagrlgseeeearlmrtlrn
ayqgtficsggytrelgieavaqgdadlvsygrlfisnpdlvmriklnaplnkynrktfy
tqdpvvgytdypfl

SCOPe Domain Coordinates for d2hsab_:

Click to download the PDB-style file with coordinates for d2hsab_.
(The format of our PDB-style files is described here.)

Timeline for d2hsab_: