Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.1: Homeodomain [46690] (41 proteins) Pfam PF00046 |
Protein Engrailed Homeodomain [46691] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [46692] (12 PDB entries) |
Domain d2hotb_: 2hot B: [165182] automated match to d1ztra1 protein/DNA complex; complexed with gol, p2o |
PDB Entry: 2hot (more details), 2.19 Å
SCOPe Domain Sequences for d2hotb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hotb_ a.4.1.1 (B:) Engrailed Homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} krprtafsseqlarlkrefnenrylterrrqqlsselglneaqvkgwfknmrakikks
Timeline for d2hotb_: