Lineage for d1mhyg_ (1mhy G:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 151161Fold a.23: Open three-helical up-and-down bundle [47143] (5 superfamilies)
  4. 151181Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) (S)
  5. 151182Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein)
  6. 151183Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)
  7. 151215Species Methylosinus trichosporium [TaxId:426] [47156] (2 PDB entries)
  8. 151216Domain d1mhyg_: 1mhy G: [16518]
    Other proteins in same PDB: d1mhyb_, d1mhyd_

Details for d1mhyg_

PDB Entry: 1mhy (more details), 2 Å

PDB Description: methane monooxygenase hydroxylase

SCOP Domain Sequences for d1mhyg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhyg_ a.23.3.1 (G:) Methane monooxygenase hydrolase, gamma subunit {Methylosinus trichosporium}
akrepihdnsirteweakiakltsvdqatkfiqdfrlaytspfrksydidvdyqyierki
eeklsvlkteklpvadlitkattgedaaaveatwiakikaakskyeaeaihiefrqlykp
pvlpvnvflrtdaalgtvlmeirntdyygtpleglrkergvkvlhlq

SCOP Domain Coordinates for d1mhyg_:

Click to download the PDB-style file with coordinates for d1mhyg_.
(The format of our PDB-style files is described here.)

Timeline for d1mhyg_: