SCOPe 2.08: Domain d1fz5e_: 1fz5 E:

Lineage for d1fz5e_ (1fz5 E:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family)
   duplication: consists of two domains of this fold
   automatically mapped to Pfam PF02964

5. Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (2 proteins)

6. Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species)

7. Species Methylococcus capsulatus [TaxId:414] [47155] (27 PDB entries)

8. Domain d1fz5e_: 1fz5 E: [16516]
   Other proteins in same PDB: d1fz5a_, d1fz5b_, d1fz5c_, d1fz5d_
   complexed with ca, fe2

Details for d1fz5e_

PDB Entry: 1fz5, 2.4 Å

PDB Description: methane monooxygenase hydroxylase, form ii crystallized anaerobically from reduced enzyme

PDB Compounds: (E:) methane monooxygenase component a, gamma chain

SCOPe Domain Sequences for d1fz5e_:

Sequence; same for both SEQRES and ATOM records:

>d1fz5e_ a.23.3.1 (E:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus [TaxId: 414]}
klgihsndtrdawvnkiaqlntlekaaemlkqfrmdhttpfrnsyeldndylwieaklee
kvavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppi
mpvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvhlqs

Timeline for d1fz5e_:

• d1fz5e_ first appeared (with stable ids) in SCOP 1.55
  
• d1fz5e_ appears in SCOPe 2.07