SCOPe 2.04: Domain d2hgza_: 2hgz A:

Lineage for d2hgza_ (2hgz A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
   contains a conserved all-alpha subdomain at the C-terminal extension

6. Protein Tyrosyl-tRNA synthetase (TyrRS) [52376] (6 species)

7. Species Methanococcus jannaschii [TaxId:2190] [89611] (7 PDB entries)

8. Domain d2hgza_: 2hgz A: [165110]
   automated match to d1j1ua_
   complexed with pbf

Details for d2hgza_

PDB Entry: 2hgz, 2.5 Å

PDB Description: crystal structure of a p-benzoyl-l-phenylalanyl-trna synthetase

PDB Compounds: (A:) Tyrosyl-tRNA synthetase

SCOPe Domain Sequences for d2hgza_:

Sequence; same for both SEQRES and ATOM records:

>d2hgza_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Methanococcus jannaschii [TaxId: 2190]}
defemikrntseiiseeelrevlkkdeksagigfepsgkihlghylqikkmidlqnagfd
iiilladlhaylnqkgeldeirkigdynkkvfeamglkakyvygspfqldkdytlnvyrl
alkttlkrarrsmeliaredenpkvaeviypimqvntshrlgvdvavggmeqrkihmlar
ellpkkvvmihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnpi
meiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikilep
irkrll

Timeline for d2hgza_:

• d2hgza_ first appeared in SCOPe 2.01
  
• d2hgza_ appears in SCOPe 2.03
  
• d2hgza_ appears in SCOPe 2.05
  
• d2hgza_ appears in the current release, SCOPe 2.08, called d2hgza1