Lineage for d2hdxd_ (2hdx D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1424633Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 1424634Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 1424635Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 1425034Protein automated matches [190202] (2 species)
    not a true protein
  7. 1425048Species Mouse (Mus musculus) [TaxId:10090] [187800] (4 PDB entries)
  8. 1425055Domain d2hdxd_: 2hdx D: [165059]
    automated match to d1rpyb_

Details for d2hdxd_

PDB Entry: 2hdx (more details), 2.35 Å

PDB Description: crystal structure of the src homology-2 domain of sh2-b in complex with jak2 ptyr813 phosphopeptide
PDB Compounds: (D:) SH2-B PH domain containing signaling mediator 1 gamma isoform

SCOPe Domain Sequences for d2hdxd_:

Sequence, based on SEQRES records: (download)

>d2hdxd_ d.93.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qplsgypwfhgmlsrlkaaqlvleggtgshgvflvrqsetrrgecvltfnfqgkakhlrl
slnaagqcrvqhlhfqsifdmlehfrvhpiplesggssdvvlvsyvps

Sequence, based on observed residues (ATOM records): (download)

>d2hdxd_ d.93.1.1 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qplsgypwfhgmlsrlkaaqlvleggtgshgvflvrqsetrrgecvltfnfqgkakhlrl
slnaagqcrvqhlhfqsifdmlehfrvhpiplessdvvlvsyvps

SCOPe Domain Coordinates for d2hdxd_:

Click to download the PDB-style file with coordinates for d2hdxd_.
(The format of our PDB-style files is described here.)

Timeline for d2hdxd_: