Lineage for d1mtyg_ (1mty G:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.23: Open three-helical up-and-down bundle [47143] (5 superfamilies) 
Superfamily a.23.3: Methane monooxygenase hydrolase, gamma subunit [47152] (1 family) 
Family a.23.3.1: Methane monooxygenase hydrolase, gamma subunit [47153] (1 protein) Protein Methane monooxygenase hydrolase, gamma subunit [47154] (2 species) Species Methylococcus capsulatus [TaxId:414] [47155] (15 PDB entries) 
Domain d1mtyg_: 1mty G: [16498]
Other proteins in same PDB: d1mtyb_, d1mtyc_, d1mtyd_, d1mtye_
Details for d1mtyg_
PDB Entry: 1mty (more details), 1.7 Å
PDB Description: methane monooxygenase hydroxylase from methylococcus capsulatus (bath)
SCOP Domain Sequences for d1mtyg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mtyg_ a.23.3.1 (G:) Methane monooxygenase hydrolase, gamma subunit {Methylococcus capsulatus}
lgihsndtrdawvnkiahvntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvh
SCOP Domain Coordinates for d1mtyg_:
Click to download the PDB-style file with coordinates for d1mtyg_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mtyg_:
- d1mtyg_ first appeared (with stable ids) in SCOP 1.55
- d1mtyg_ appears in SCOP 1.59
- d1mtyg_ appears in SCOP 1.63
- d1mtyg_ appears in the current release, SCOPe 2.08
View in 3D
