Lineage for d2h47g_ (2h47 G:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1704092Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 1704093Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 1704189Family g.21.1.0: automated matches [191380] (1 protein)
    not a true family
  6. 1704190Protein automated matches [190474] (1 species)
    not a true protein
  7. 1704191Species Alcaligenes faecalis [TaxId:511] [187398] (27 PDB entries)
  8. 1704246Domain d2h47g_: 2h47 G: [164934]
    Other proteins in same PDB: d2h47c_
    automated match to d1mg2b_
    complexed with cu

Details for d2h47g_

PDB Entry: 2h47 (more details), 2.6 Å

PDB Description: Crystal Structure of an Electron Transfer Complex Between Aromatic Amine Dephydrogenase and Azurin from Alcaligenes Faecalis (Form 1)
PDB Compounds: (G:) Aromatic amine dehydrogenase

SCOPe Domain Sequences for d2h47g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h47g_ g.21.1.0 (G:) automated matches {Alcaligenes faecalis [TaxId: 511]}
gadhislnpdlanedevnscdywrhcavdgflcsccggttttcppgstpspiswigtchn
phdgkdylisyhdccgktacgrcqcntqtrerpgyefflhndvnwcmanenstfhcttsv
lvglak

SCOPe Domain Coordinates for d2h47g_:

Click to download the PDB-style file with coordinates for d2h47g_.
(The format of our PDB-style files is described here.)

Timeline for d2h47g_: