Class g: Small proteins [56992] (91 folds) |
Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily) disulfide-rich; nearly all-beta |
Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) |
Family g.21.1.0: automated matches [191380] (1 protein) not a true family |
Protein automated matches [190474] (1 species) not a true protein |
Species Alcaligenes faecalis [TaxId:511] [187398] (27 PDB entries) |
Domain d2h47g_: 2h47 G: [164934] Other proteins in same PDB: d2h47c_ automated match to d1mg2b_ complexed with cu |
PDB Entry: 2h47 (more details), 2.6 Å
SCOPe Domain Sequences for d2h47g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h47g_ g.21.1.0 (G:) automated matches {Alcaligenes faecalis [TaxId: 511]} gadhislnpdlanedevnscdywrhcavdgflcsccggttttcppgstpspiswigtchn phdgkdylisyhdccgktacgrcqcntqtrerpgyefflhndvnwcmanenstfhcttsv lvglak
Timeline for d2h47g_:
View in 3D Domains from other chains: (mouse over for more information) d2h47b_, d2h47c_, d2h47e_, d2h47i_ |