SCOPe 2.07: Domain d1fpob2: 1fpo B:77-171

Lineage for d1fpob2 (1fpo B:77-171)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.1: HSC20 (HSCB), C-terminal oligomerisation domain [47144] (1 family)
   automatically mapped to Pfam PF07743

5. Family a.23.1.1: HSC20 (HSCB), C-terminal oligomerisation domain [47145] (1 protein)

6. Protein HSC20 (HSCB), C-terminal oligomerisation domain [47146] (1 species)

7. Species Escherichia coli [TaxId:562] [47147] (1 PDB entry)

8. Domain d1fpob2: 1fpo B:77-171 [16488]
   Other proteins in same PDB: d1fpoa1, d1fpob1, d1fpoc1

Details for d1fpob2

PDB Entry: 1fpo, 1.8 Å

PDB Description: hsc20 (hscb), a j-type co-chaperone from e. coli

PDB Compounds: (B:) chaperone protein hscb

SCOPe Domain Sequences for d1fpob2:

Sequence; same for both SEQRES and ATOM records:

>d1fpob2 a.23.1.1 (B:77-171) HSC20 (HSCB), C-terminal oligomerisation domain {Escherichia coli [TaxId: 562]}
fdlaseqhtvrdtaflmeqlelreeldeieqakdearlesfikrvkkmfdtrhqlmveql
dnetwdaaadtcrklrfldklrssaeqleeklldf

Timeline for d1fpob2:

• d1fpob2 first appeared (with stable ids) in SCOP 1.55
  
• d1fpob2 appears in SCOPe 2.06
  
• d1fpob2 appears in the current release, SCOPe 2.08