Lineage for d2hioc_ (2hio C:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.22: Histone-fold [47112] (1 superfamily) Superfamily a.22.1: Histone-fold [47113] (3 families) 
Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) 
Protein Histone H3 [47122] (2 species) Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47123] (4 PDB entries) 
Domain d2hioc_: 2hio C: [16458]
Other proteins in same PDB: d2hioa_, d2hiob_, d2hiod_
Details for d2hioc_
PDB Entry: 2hio (more details), 3.1 Å
PDB Description: histone octamer (chicken), chromosomal protein
SCOP Domain Sequences for d2hioc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hioc_ a.22.1.1 (C:) Histone H3 {Chicken (Gallus gallus), erythrocytes}
pgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvg
lfedtnlcaihakrvtimpkdiqlarrirgera
SCOP Domain Coordinates for d2hioc_:
Click to download the PDB-style file with coordinates for d2hioc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2hioc_:
- d2hioc_ appears in SCOP 1.57
- d2hioc_ appears in the current release, SCOPe 2.08
View in 3D
