Lineage for d1f66g_ (1f66 G:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.22: Histone-fold [47112] (1 superfamily) Superfamily a.22.1: Histone-fold [47113] (3 families) 
Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) Protein Histone H2A [47115] (3 species) 
Species Human (Homo sapiens), variant H2A.Z [TaxId:9606] [47118] (1 PDB entry) 
Domain d1f66g_: 1f66 G: [16443]
Other proteins in same PDB: d1f66a_, d1f66b_, d1f66d_, d1f66e_, d1f66f_, d1f66h_
Details for d1f66g_
PDB Entry: 1f66 (more details), 2.6 Å
PDB Description: 2.6 a crystal structure of a nucleosome core particle containing the variant histone h2a.z
SCOP Domain Sequences for d1f66g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f66g_ a.22.1.1 (G:) Histone H2A {Human (Homo sapiens), variant H2A.Z}
avsrsqraglqfpvgrihrhlksrttshgrvgataavysaaileyltaevlelagnaskd
lkvkritprhlqlairgdeeldslikatiagggviphihksligkkg
SCOP Domain Coordinates for d1f66g_:
Click to download the PDB-style file with coordinates for d1f66g_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f66g_:
- d1f66g_ appears in SCOP 1.57
- d1f66g_ appears in the current release, SCOPe 2.08
View in 3D
