Lineage for d2fava_ (2fav A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2489006Fold c.50: Macro domain-like [52948] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest
  4. 2489007Superfamily c.50.1: Macro domain-like [52949] (4 families) (S)
  5. 2489032Family c.50.1.2: Macro domain [89724] (7 proteins)
    found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme
  6. 2489075Protein automated matches [190472] (8 species)
    not a true protein
  7. 2489130Species SARS coronavirus [TaxId:227859] [187695] (257 PDB entries)
  8. 2489602Domain d2fava_: 2fav A: [164313]
    automated match to d2acfa1
    complexed with apr

Details for d2fava_

PDB Entry: 2fav (more details), 1.8 Å

PDB Description: Crystal structure of SARS macro domain in complex with ADP-ribose at 1.8 A resolution
PDB Compounds: (A:) Replicase polyprotein 1ab (pp1ab) (ORF1AB)

SCOPe Domain Sequences for d2fava_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fava_ c.50.1.2 (A:) automated matches {SARS coronavirus [TaxId: 227859]}
epvnqftgylkltdnvaikcvdivkeaqsanpmvivnaanihlkhgggvagalnkatnga
mqkesddyiklngpltvggscllsghnlakkclhvvgpnlnagediqllkaayenfnsqd
illapllsagifgakplqslqvcvqtvrtqvyiavndkalyeqvvmdyldnl

SCOPe Domain Coordinates for d2fava_:

Click to download the PDB-style file with coordinates for d2fava_.
(The format of our PDB-style files is described here.)

Timeline for d2fava_: