Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
Superfamily c.50.1: Macro domain-like [52949] (4 families) |
Family c.50.1.2: Macro domain [89724] (7 proteins) found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme |
Protein automated matches [190472] (8 species) not a true protein |
Species SARS coronavirus [TaxId:227859] [187695] (257 PDB entries) |
Domain d2fava_: 2fav A: [164313] automated match to d2acfa1 complexed with apr |
PDB Entry: 2fav (more details), 1.8 Å
SCOPe Domain Sequences for d2fava_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fava_ c.50.1.2 (A:) automated matches {SARS coronavirus [TaxId: 227859]} epvnqftgylkltdnvaikcvdivkeaqsanpmvivnaanihlkhgggvagalnkatnga mqkesddyiklngpltvggscllsghnlakkclhvvgpnlnagediqllkaayenfnsqd illapllsagifgakplqslqvcvqtvrtqvyiavndkalyeqvvmdyldnl
Timeline for d2fava_: