Lineage for d1qrva_ (1qrv A:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2075Fold a.21: HMG-box [47094] (1 superfamily)
  4. 2076Superfamily a.21.1: HMG-box [47095] (1 family) (S)
  5. 2077Family a.21.1.1: HMG-box [47096] (7 proteins)
  6. 2078Protein HMG-D [47100] (1 species)
  7. 2079Species Drosophila melanogaster [TaxId:7227] [47101] (2 PDB entries)
  8. 2080Domain d1qrva_: 1qrv A: [16425]

Details for d1qrva_

PDB Entry: 1qrv (more details), 2.2 Å

PDB Description: crystal structure of the complex of hmg-d and dna

SCOP Domain Sequences for d1qrva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster}
sdkpkrplsaymlwlnsaresikrenpgikvtevakrggelwramkdkseweakaakakd
dydravkefeang

SCOP Domain Coordinates for d1qrva_:

Click to download the PDB-style file with coordinates for d1qrva_.
(The format of our PDB-style files is described here.)

Timeline for d1qrva_:

2080
d1qrva_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1qrvb_