Lineage for d2ek1b1 (2ek1 B:875-949)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2558725Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2558726Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2559203Protein automated matches [190332] (5 species)
    not a true protein
  7. 2559214Species Human (Homo sapiens) [TaxId:9606] [187155] (30 PDB entries)
  8. 2559232Domain d2ek1b1: 2ek1 B:875-949 [164108]
    Other proteins in same PDB: d2ek1a2, d2ek1b2, d2ek1c2, d2ek1d2, d2ek1e2, d2ek1f2, d2ek1g2, d2ek1h2
    automated match to d2cqpa1

Details for d2ek1b1

PDB Entry: 2ek1 (more details), 2 Å

PDB Description: Crystal structure of RNA-binding motif of human rna-binding protein 12
PDB Compounds: (B:) RNA-binding protein 12

SCOPe Domain Sequences for d2ek1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ek1b1 d.58.7.1 (B:875-949) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptvikvqnmpftvsideildffygyqvipgsvclkynekgmptgeamvafesrdeataav
idlndrpigsrkvkl

SCOPe Domain Coordinates for d2ek1b1:

Click to download the PDB-style file with coordinates for d2ek1b1.
(The format of our PDB-style files is described here.)

Timeline for d2ek1b1: