Lineage for d2eg9a_ (2eg9 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2466660Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 2466704Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins)
    contains extra N-terminal all-alpha subdomain
    automatically mapped to Pfam PF02267
  6. 2466705Protein ADP ribosyl cyclase [56631] (4 species)
  7. 2466821Species Mouse (Mus musculus) [TaxId:10090] [188367] (1 PDB entry)
  8. 2466822Domain d2eg9a_: 2eg9 A: [163995]
    automated match to d2ef1b1

Details for d2eg9a_

PDB Entry: 2eg9 (more details), 2.8 Å

PDB Description: crystal structure of the truncated extracellular domain of mouse cd38
PDB Compounds: (A:) ADP-ribosyl cyclase 1

SCOPe Domain Sequences for d2eg9a_:

Sequence, based on SEQRES records: (download)

>d2eg9a_ c.23.14.3 (A:) ADP ribosyl cyclase {Mouse (Mus musculus) [TaxId: 10090]}
llvwtgepttkhfsdiflgrcliytqilrpemrdqncqeilstfkgafvsknpcditred
yaplvklvtqtipcdktlfwskskhlahqytwiqgkmftledtllgyiaddlrwcgdpst
sdmnyvscphwsencpnnpitmfwkvisqkfaedacgvvqvmldgslrepfykdstfgsv
evfsldpnkvhklqawvmhdiegassnacsssslnelkmivqkrnmifacvdny

Sequence, based on observed residues (ATOM records): (download)

>d2eg9a_ c.23.14.3 (A:) ADP ribosyl cyclase {Mouse (Mus musculus) [TaxId: 10090]}
llvwtgepttkhfsdiflgrcliytqilrpemrdqncqeilstfkgafvsknpcditred
yaplvklvtqtipcdktlfwftledtllgyiaddlrwcgdpstsdmnyvscphcpnnpit
mfwkvisqkfaedacgvvqvmldgslrepfykdstfgsvevfsldpnkvhklqawvmhdi
egassnacsssslnelkmivqkrnmifacvdny

SCOPe Domain Coordinates for d2eg9a_:

Click to download the PDB-style file with coordinates for d2eg9a_.
(The format of our PDB-style files is described here.)

Timeline for d2eg9a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2eg9b_