Lineage for d2eenb_ (2een B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563399Fold d.63: CYTH-like phosphatases [55153] (1 superfamily)
    duplication of beta-alpha-beta(3) motif: antiparallel beta sheet forms wide barrel (n=8, S=16) with a channel running through it
  4. 2563400Superfamily d.63.1: CYTH-like phosphatases [55154] (3 families) (S)
  5. 2563449Family d.63.1.0: automated matches [191434] (1 protein)
    not a true family
  6. 2563450Protein automated matches [190625] (4 species)
    not a true protein
  7. 2563451Species Pyrococcus horikoshii [TaxId:53953] [187660] (1 PDB entry)
  8. 2563453Domain d2eenb_: 2een B: [163962]
    automated match to d1yemb_

Details for d2eenb_

PDB Entry: 2een (more details), 1.65 Å

PDB Description: Structure of PH1819 protein from Pyrococcus Horikoshii OT3
PDB Compounds: (B:) Hypothetical protein PH1819

SCOPe Domain Sequences for d2eenb_:

Sequence, based on SEQRES records: (download)

>d2eenb_ d.63.1.0 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
evelkgyandeifekvretfefmrkeihediyyqhpcrdfsktdealririkrfnghnev
fltykgpkideksktrleieveiqedvdkyfelldrlgfkevlkvvktrekyyvekgvti
tldeveglgkfieietlvkekdeipeaveklekilrelgvekferrsylelllekrteln

Sequence, based on observed residues (ATOM records): (download)

>d2eenb_ d.63.1.0 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
evelkgyandeifekvretfefmrkeihediyyqhpcrdfsktdealririkrfnghnev
fltykgpleieveiqedvdkyfelldrlgfkevlkvvktrekyyvekgvtitldeveglg
kfieietlvaveklekilrelgvekferrsylelllekrteln

SCOPe Domain Coordinates for d2eenb_:

Click to download the PDB-style file with coordinates for d2eenb_.
(The format of our PDB-style files is described here.)

Timeline for d2eenb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2eena_