SCOPe 2.07: Domain d2eb6b_: 2eb6 B:

Lineage for d2eb6b_ (2eb6 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.177: FAH [56528] (1 superfamily)
   unusual fold; contains 3 layers of beta-sheet structure

4. Superfamily d.177.1: FAH [56529] (2 families)

5. Family d.177.1.0: automated matches [191367] (1 protein)
   not a true family

6. Protein automated matches [190444] (5 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187351] (3 PDB entries)

8. Domain d2eb6b_: 2eb6 B: [163942]
   automated match to d1sv6a_
   complexed with mg

Details for d2eb6b_

PDB Entry: 2eb6, 1.69 Å

PDB Description: Crystal structure of HpcG complexed with Mg ion

PDB Compounds: (B:) 2-oxo-hept-3-ene-1,7-dioate hydratase

SCOPe Domain Sequences for d2eb6b_:

Sequence; same for both SEQRES and ATOM records:

>d2eb6b_ d.177.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
mfdkhthtliaqrldqaekqreqiraisldypeitiedayavqrewvrlkiaegrtlkgh
kigltskamqassqisepdygallddmffhdgsdiptdrfivprievelafvlakplrgp
nctlfdvynatdyvipalelidarchnidpetqrprkvfdtisdnaanagvilggrpikp
deldlrwisalmyrngvieetgvaagvlnhpangvawlanklapydvqleagqiilggsf
trpvparkgdtfhvdygnmgsiscrfv

Timeline for d2eb6b_:

• d2eb6b_ first appeared in SCOPe 2.01
  
• d2eb6b_ appears in SCOPe 2.06
  
• d2eb6b_ appears in the current release, SCOPe 2.08