SCOPe 2.07: Domain d2e7ab_: 2e7a B:

Lineage for d2e7ab_ (2e7a B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein automated matches [190204] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186956] (14 PDB entries)

8. Domain d2e7ab_: 2e7a B: [163889]
   automated match to d1a8ma_
   mutant

Details for d2e7ab_

PDB Entry: 2e7a, 1.8 Å

PDB Description: tnf receptor subtype one-selective tnf mutant with antagonistic activity

PDB Compounds: (B:) Tumor necrosis factor

SCOPe Domain Sequences for d2e7ab_:

Sequence, based on SEQRES records:

>d2e7ab_ b.22.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfsgq
gcpsthvllthtisristthnqpvnllsairspcqretpegaeanpwyepiylggvfqle
pgdrlsaeinrpdyldfaesgqvyfgiial

Sequence, based on observed residues (ATOM records):

>d2e7ab_ b.22.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfsgq
gcpsthvllthtisristthnqpvnllsairspcqanpwyepiylggvfqlepgdrlsae
inrpdyldfaesgqvyfgiial

Timeline for d2e7ab_:

• d2e7ab_ first appeared in SCOPe 2.01
  
• d2e7ab_ appears in SCOPe 2.06
  
• d2e7ab_ appears in the current release, SCOPe 2.08