Lineage for d2e77b_ (2e77 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2436512Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2437126Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2437127Protein automated matches [190048] (31 species)
    not a true protein
  7. 2437128Species Aerococcus viridans [TaxId:1377] [187639] (8 PDB entries)
  8. 2437134Domain d2e77b_: 2e77 B: [163885]
    automated match to d1tb3a1
    complexed with fmn, pyr

Details for d2e77b_

PDB Entry: 2e77 (more details), 1.9 Å

PDB Description: Crystal structure of L-lactate oxidase with pyruvate complex
PDB Compounds: (B:) Lactate oxidase

SCOPe Domain Sequences for d2e77b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e77b_ c.1.4.0 (B:) automated matches {Aerococcus viridans [TaxId: 1377]}
eynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkhkllypr
laqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtimsisaysg
atfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgnrdrdvk
nkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaghsglpvfvkgiqhp
edadmaikrgasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvrrgehva
kalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedlkgldlf
dnpygyey

SCOPe Domain Coordinates for d2e77b_:

Click to download the PDB-style file with coordinates for d2e77b_.
(The format of our PDB-style files is described here.)

Timeline for d2e77b_: