Lineage for d2drsa_ (2drs A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1498423Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1498424Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 1498441Family a.102.1.2: Cellulases catalytic domain [48213] (12 proteins)
  6. 1498527Protein Xylanase Y [140784] (1 species)
  7. 1498528Species Bacillus halodurans [TaxId:86665] [140785] (7 PDB entries)
    Uniprot Q9KB30 6-381
  8. 1498535Domain d2drsa_: 2drs A: [163667]
    automated match to d1wu4a1
    complexed with gol, ni; mutant

Details for d2drsa_

PDB Entry: 2drs (more details), 2.1 Å

PDB Description: crystal structure of reducing-end-xylose releasing exo-oligoxylanase d263s mutant
PDB Compounds: (A:) Xylanase Y

SCOPe Domain Sequences for d2drsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2drsa_ a.102.1.2 (A:) Xylanase Y {Bacillus halodurans [TaxId: 86665]}
kttegafytreyrnlfkefgyseaeiqervkdtweqlfgdnpetkiyyevgddlgylldt
gnldvrtegmsygmmmavqmdrkdifdriwnwtmknmymtegvhagyfawscqpdgtkns
wgpapdgeeyfalalffashrwgdgdeqpfnyseqarkllhtcvhngeggpghpmwnrdn
klikfipevefsdpsyhlphfyelfslwaneedrvfwkeaaeasreylkiachpetglap
eyayydgtpndekgyghffsssyrvaanigldaewfggsewsaeeinkiqaffadkeped
yrrykidgepfeekslhpvgliatnamgslasvdgpyakanvdlfwntpvrtgnrryydn
clylfamlalsgnfkiwfp

SCOPe Domain Coordinates for d2drsa_:

Click to download the PDB-style file with coordinates for d2drsa_.
(The format of our PDB-style files is described here.)

Timeline for d2drsa_: