Lineage for d2dffa_ (2dff A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1373755Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1373756Family c.55.3.1: Ribonuclease H [53099] (5 proteins)
  6. 1373992Protein automated matches [190266] (7 species)
    not a true protein
  7. 1374012Species Thermococcus kodakarensis [TaxId:69014] [187055] (3 PDB entries)
  8. 1374015Domain d2dffa_: 2dff A: [163624]
    automated match to d1io2a_

Details for d2dffa_

PDB Entry: 2dff (more details), 2.7 Å

PDB Description: Crystal structure of Tk-RNase HII(1-204)-C
PDB Compounds: (A:) ribonuclease hii

SCOPe Domain Sequences for d2dffa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dffa_ c.55.3.1 (A:) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
mkiagideagrgpvigpmviaavvvdenslpkleelkvrdskkltpkrreklfneilgvl
ddyvilelppdvigsregtlnefevenfakalnslkvkpdviyadaadvdeerfarelge
rlnfeaevvakhkaddifpvvsaasilakvtrdraveklkeeygeigsgypsdprtrafl
enyyrehgefppivrkgwktlkkitqdmin

SCOPe Domain Coordinates for d2dffa_:

Click to download the PDB-style file with coordinates for d2dffa_.
(The format of our PDB-style files is described here.)

Timeline for d2dffa_: