![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.1: Ribonuclease H [53099] (5 proteins) |
![]() | Protein automated matches [190266] (7 species) not a true protein |
![]() | Species Thermococcus kodakarensis [TaxId:69014] [187055] (3 PDB entries) |
![]() | Domain d2dffa_: 2dff A: [163624] automated match to d1io2a_ |
PDB Entry: 2dff (more details), 2.7 Å
SCOPe Domain Sequences for d2dffa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dffa_ c.55.3.1 (A:) automated matches {Thermococcus kodakarensis [TaxId: 69014]} mkiagideagrgpvigpmviaavvvdenslpkleelkvrdskkltpkrreklfneilgvl ddyvilelppdvigsregtlnefevenfakalnslkvkpdviyadaadvdeerfarelge rlnfeaevvakhkaddifpvvsaasilakvtrdraveklkeeygeigsgypsdprtrafl enyyrehgefppivrkgwktlkkitqdmin
Timeline for d2dffa_: