SCOPe 2.08: Domain d1deeh_: 1dee H:

Lineage for d1deeh_ (1dee H:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families)

5. Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
   automatically mapped to Pfam PF02216

6. Protein Immunoglobulin-binding protein A modules [46999] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [47000] (27 PDB entries)

8. Domain d1deeh_: 1dee H: [16344]
   Other proteins in same PDB: d1deea1, d1deea2, d1deeb1, d1deeb2, d1deec1, d1deec2, d1deed1, d1deed2, d1deee1, d1deee2, d1deef1, d1deef2
   domain D

Details for d1deeh_

PDB Entry: 1dee, 2.7 Å

PDB Description: structure of s. aureus protein a bound to a human igm fab

PDB Compounds: (H:) immunoglobulin g binding protein a

SCOPe Domain Sequences for d1deeh_:

Sequence; same for both SEQRES and ATOM records:

>d1deeh_ a.8.1.1 (H:) Immunoglobulin-binding protein A modules {Staphylococcus aureus [TaxId: 1280]}
fnkdqqsafyeilnmpnlneaqrngfiqslkddpsqstnvlgeakklnesqapk

Timeline for d1deeh_:

• d1deeh_ first appeared (with stable ids) in SCOP 1.55
  
• d1deeh_ appears in SCOPe 2.07