Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins) |
Protein automated matches [190133] (5 species) not a true protein |
Species Clostridium botulinum [TaxId:1491] [187018] (9 PDB entries) |
Domain d2c8cb_: 2c8c B: [163301] automated match to d1g24a_ complexed with adp, nad; mutant |
PDB Entry: 2c8c (more details), 2.7 Å
SCOPe Domain Sequences for d2c8cb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c8cb_ d.166.1.1 (B:) automated matches {Clostridium botulinum [TaxId: 1491]} sntyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfps nlikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakf lnkdrleygyistslmnvsqfagrpiitkfkvakgskagyidpisafagalemllprhst yhiddmrlssdgkqiiitatmmgta
Timeline for d2c8cb_: