SCOPe 2.03: Domain d2bpha_: 2bph A:

Lineage for d2bpha_ (2bph A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (8 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187331] (13 PDB entries)

8. Domain d2bpha_: 2bph A: [163142]
   automated match to d1ypqa1
   complexed with mg

Details for d2bpha_

PDB Entry: 2bph, 2.2 Å

PDB Description: structure of murine dectin-1

PDB Compounds: (A:) dectin-1

SCOPe Domain Sequences for d2bpha_:

Sequence; same for both SEQRES and ATOM records:

>d2bpha_ d.169.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qsclpnwimhgkscylfsfsgnswygskrhcsqlgahllkidnskefefiesqtsshrin
afwiglsrnqsegpwfwedgsaffpnsfqvrnavpqesllhncvwihgsevynqicntss
ysicekelk

Timeline for d2bpha_:

• d2bpha_ first appeared in SCOPe 2.01
  
• d2bpha_ appears in SCOPe 2.02
  
• d2bpha_ appears in SCOPe 2.04
  
• d2bpha_ appears in the current release, SCOPe 2.08, called d2bpha1