Lineage for d2bjob_ (2bjo B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2613735Fold d.227: OsmC-like [82783] (1 superfamily)
    swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix
  4. 2613736Superfamily d.227.1: OsmC-like [82784] (3 families) (S)
  5. 2613815Family d.227.1.0: automated matches [191395] (1 protein)
    not a true family
  6. 2613816Protein automated matches [190512] (7 species)
    not a true protein
  7. 2613817Species Bacillus subtilis [TaxId:1423] [187466] (1 PDB entry)
  8. 2613819Domain d2bjob_: 2bjo B: [163111]
    automated match to d1uspa_

Details for d2bjob_

PDB Entry: 2bjo (more details), 2.1 Å

PDB Description: crystal structure of the organic hydroperoxide resistance protein ohrb of bacillus subtilis
PDB Compounds: (B:) organic hydroperoxide resistance protein ohrb

SCOPe Domain Sequences for d2bjob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bjob_ d.227.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
alftakvtarggraghitsddgvldfdivmpnaaaagqtgtnpeqlfaagyaacfggale
hvakeqnieidseiegqvslmkdesdggfkigvtlvvntkdldrekaqelvnaahefcpy
skatrgnvdvklelk

SCOPe Domain Coordinates for d2bjob_:

Click to download the PDB-style file with coordinates for d2bjob_.
(The format of our PDB-style files is described here.)

Timeline for d2bjob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bjoa_