SCOP 1.59: Domain d1exja1: 1exj A:3-120

Lineage for d1exja1 (1exj A:3-120)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (3 families)

5. Family a.6.1.3: DNA-binding N-terminal domain of transcription activators [46962] (2 proteins)

6. Protein Transcription activator BmrR [46963] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [46964] (2 PDB entries)

8. Domain d1exja1: 1exj A:3-120 [16309]
   Other proteins in same PDB: d1exja2

Details for d1exja1

PDB Entry: 1exj, 3 Å

PDB Description: crystal structure of transcription activator bmrr, from b. subtilis, bound to 21 base pair bmr operator and tpp

SCOP Domain Sequences for d1exja1:

Sequence; same for both SEQRES and ATOM records:

>d1exja1 a.6.1.3 (A:3-120) Transcription activator BmrR {Bacillus subtilis}
esyysigevsklanvsikalryydkidlfkpayvdpdtsyryytdsqlihldlikslkyi
gtpleemkkaqdlemeelfafyteqerqirekldflsaleqtislvkkrmkrqmeypa

Timeline for d1exja1:

• d1exja1 first appeared (with stable ids) in SCOP 1.55
  
• d1exja1 appears in SCOP 1.57
  
• d1exja1 appears in SCOP 1.61
  
• d1exja1 appears in the current release, SCOPe 2.08