Lineage for d2bdzd_ (2bdz D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1398964Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1398965Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1398966Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 1399284Protein automated matches [190264] (9 species)
    not a true protein
  7. 1399314Species Jacaratia mexicana [TaxId:309130] [187452] (1 PDB entry)
  8. 1399318Domain d2bdzd_: 2bdz D: [163051]
    automated match to d1yala_
    complexed with e64

Details for d2bdzd_

PDB Entry: 2bdz (more details), 2.1 Å

PDB Description: mexicain from jacaratia mexicana
PDB Compounds: (D:) Mexicain

SCOPe Domain Sequences for d2bdzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bdzd_ d.3.1.1 (D:) automated matches {Jacaratia mexicana [TaxId: 309130]}
ypesidwrekgavtpvknqnpcgscwafstvatieginkiitgqlislseqelldcerrs
hgcdggyqttslqyvvdngvhtereypyekkqgrcrakdkkgpkvyitgykyvpandeis
liqaianqpvsvvtdsrgrgfqfykggiyegpcgtntdhavtavgygktylllknswgpn
wgekgyirikrasgrskgtcgvytssffpikg

SCOPe Domain Coordinates for d2bdzd_:

Click to download the PDB-style file with coordinates for d2bdzd_.
(The format of our PDB-style files is described here.)

Timeline for d2bdzd_: