Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (23 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.1: Papain-like [54002] (26 proteins) |
Protein automated matches [190264] (9 species) not a true protein |
Species Jacaratia mexicana [TaxId:309130] [187452] (1 PDB entry) |
Domain d2bdzd_: 2bdz D: [163051] automated match to d1yala_ complexed with e64 |
PDB Entry: 2bdz (more details), 2.1 Å
SCOPe Domain Sequences for d2bdzd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bdzd_ d.3.1.1 (D:) automated matches {Jacaratia mexicana [TaxId: 309130]} ypesidwrekgavtpvknqnpcgscwafstvatieginkiitgqlislseqelldcerrs hgcdggyqttslqyvvdngvhtereypyekkqgrcrakdkkgpkvyitgykyvpandeis liqaianqpvsvvtdsrgrgfqfykggiyegpcgtntdhavtavgygktylllknswgpn wgekgyirikrasgrskgtcgvytssffpikg
Timeline for d2bdzd_: